General Information

  • ID:  hor001190
  • Uniprot ID:  A8X1A3
  • Protein name:  FMRFamide-like peptide
  • Gene name:  flp-13
  • Organism:  Caenorhabditis briggsae
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045187 regulation of circadian sleep/wake cycle, sleep; GO:1900034 regulation of cellular response to heat
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SPSAAPLIRF
  • Length:  10
  • Propeptide:  MMTSLLVIPMMFVVAIQAFDSSEIRMLDEQYETNHPYFPFLEQKRSDRPTRAMDSPLIRFGKRAADGAPLIRFGRAPEASPFIRFGKRAADGAPLIRFGRAPEASPFIRFGKRAAPSAPLIRFGRSPSAAPLIRFGRSAAAPLIRFGRASSAPLIRFGRK
  • Signal peptide:  MMTSLLVIPMMFVVAIQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A8X1A3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001190_AF2.pdbhor001190_ESM.pdb

Physical Information

Mass: 121895 Formula: C49H79N13O13
Absent amino acids: CDEGHKMNQTVWY Common amino acids: APS
pI: 10.55 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 5
Hydrophobicity: 54 Boman Index: -528
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 98
Instability Index: 9146 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  18760316
  • Title:  Comparative Peptidomics of Caenorhabditis Elegans Versus C. Briggsae by LC-MALDI-TOF MS